| Edit |   |
| Antigenic Specificity | Meiosis 1 Associated Protein |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Meiosis 1 Associated Protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to Meiosis 1 Associated Protein. This antibody reacts with human. The Meiosis 1 Associated Protein Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FLJ35848(hypothetical protein FLJ35848) The peptide sequence was selected from the C terminal of FLJ35848. Peptide sequence LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP. |
| Other Names | chromosome 17 open reading frame 104, FLJ40428, hypothetical protein LOC284071, MGC43301 |
| Gene, Accession # | C17orf104, Gene ID: 284071 |
| Catalog # | NBP1-70441 |
| Price | |
| Order / More Info | Meiosis 1 Associated Protein Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |