| Edit |   |
|---|
| Antigenic Specificity | Meiosis 1 Associated Protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Meiosis 1 Associated Protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to Meiosis 1 Associated Protein. This antibody reacts with human. The Meiosis 1 Associated Protein Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FLJ35848(hypothetical protein FLJ35848) The peptide sequence was selected from the C terminal of FLJ35848. Peptide sequence LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP. |
|---|
| Other Names | chromosome 17 open reading frame 104, FLJ40428, hypothetical protein LOC284071, MGC43301 |
|---|
| Gene, Accession # | C17orf104, Gene ID: 284071 |
|---|
| Catalog # | NBP1-70441-20ul |
|---|
| Price | |
|---|
| Order / More Info | Meiosis 1 Associated Protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|