| Edit |   |
|---|
| Antigenic Specificity | MEIOB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MEIOB Antibody from Novus Biologicals is a rabbit polyclonal antibody to MEIOB. This antibody reacts with human. The MEIOB Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NMANLKVIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASW GNEDYIKSLSDSFRVGDCVIIENPLIQRKEI |
|---|
| Other Names | C16orf73, chromosome 16 open reading frame 73, gs129, meiosis specific with OB domains |
|---|
| Gene, Accession # | MEIOB, Gene ID: 254528 |
|---|
| Catalog # | NBP2-14385 |
|---|
| Price | |
|---|
| Order / More Info | MEIOB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|