| Edit |   |
|---|
| Antigenic Specificity | MEGF11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MEGF11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MEGF11. This antibody reacts with human. The MEGF11 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human MEGF11. Peptide sequence LMMEELNPYTKISPALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQ. |
|---|
| Other Names | DKFZp434L121, KIAA1781, multiple EGF-like domains protein 11, multiple EGF-like-domains 11, multiple epidermal growth factor-like domains protein 11 |
|---|
| Gene, Accession # | MEGF11, Gene ID: 84465, Accession: NP_115821, SwissProt: NP_115821 |
|---|
| Catalog # | NBP1-91360 |
|---|
| Price | |
|---|
| Order / More Info | MEGF11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|