| Edit |   |
| Antigenic Specificity | MEGF11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MEGF11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MEGF11. This antibody reacts with human. The MEGF11 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human MEGF11. Peptide sequence LMMEELNPYTKISPALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQ. |
| Other Names | DKFZp434L121, KIAA1781, multiple EGF-like domains protein 11, multiple EGF-like-domains 11, multiple epidermal growth factor-like domains protein 11 |
| Gene, Accession # | MEGF11, Gene ID: 84465, Accession: NP_115821, SwissProt: NP_115821 |
| Catalog # | NBP1-91360-20ul |
| Price | |
| Order / More Info | MEGF11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |