| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FKBPL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FKBPL Antibody from Novus Biologicals is a rabbit polyclonal antibody to FKBPL. This antibody reacts with human. The FKBPL Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FKBPL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGN LEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQ |
|---|
| Other Names | DIR1WISP39, FK506 binding protein like, FK506-binding protein like, NG7FK506-binding protein-like, WAF-1/CIP1 stabilizing protein 39, WISp39 |
|---|
| Gene, Accession # | FKBPL, Gene ID: 63943 |
|---|
| Catalog # | NBP2-14018 |
|---|
| Price | |
|---|
| Order / More Info | FKBPL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|