| 产品详情 |
| Edit |   |
| Antigenic Specificity | FKBP52/FKBP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FKBP52/FKBP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FKBP52/FKBP4. This antibody reacts with human. The FKBP52/FKBP4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FKBP52/FKBP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE |
| Other Names | 51 kDa FK506-binding protein, 52 kDa FKBP, 59 kDa immunophilin, EC 5.2.1.8, FK506 binding protein 4, 59kDa, FK506-binding protein 4, FK506-binding protein 4 (59kD), FKBP-4, FKBP51, FKBP-52, FKBP52T-cell FK506-binding protein, 59kD, FKBP5952 kDa FK506-binding protein, HBI, HSP binding immunophilin, Hsp56, HSP-binding immunophilin, Immunophilin FKBP52, p52, p59, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP4, PPIase, PPIase FKBP4, Rotamase |
| Gene, Accession # | FKBP4, Gene ID: 2288 |
| Catalog # | NBP2-56131 |
| Price | |
| Order / More Info | FKBP52/FKBP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|