| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FKBP51/FKBP5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FKBP51/FKBP5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FKBP51/FKBP5. This antibody reacts with human, mouse, rat. The FKBP51/FKBP5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat FKBP51/FKBP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE |
|---|
| Other Names | 51 kDa FKBP, 54 kDa progesterone receptor-associated immunophilin, AIG6,51 kDa FK506-binding protein, Androgen-regulated protein 6, FF1 antigen, FK506 binding protein 5, FK506-binding protein 5, FKBP-5, FKBP-51, FKBP51PPIase FKBP5, FKBP54EC 5.2.1.8, HSP90-binding immunophilin, MGC111006, p54, P54,51 kDa FK506-binding protein 5, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP5, PPIase, Ptg-10, rotamase, T-cell FK506-binding protein |
|---|
| Gene, Accession # | FKBP5, Gene ID: 2289 |
|---|
| Catalog # | NBP1-84676 |
|---|
| Price | |
|---|
| Order / More Info | FKBP51/FKBP5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|