| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Factor IX |
|---|
| Clone | 2C9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation, RNA Inhibition. Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Factor IX Antibody (2C9) from Novus Biologicals is a mouse monoclonal antibody to Factor IX. This antibody reacts with human. The Factor IX Antibody (2C9) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation, RNA Inhibition. |
|---|
| Immunogen | F9 (NP_000124, 96 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT |
|---|
| Other Names | Christmas factor, coagulation factor IX, EC 3.4.21, EC 3.4.21.22, factor 9, FIX, HEMB, MGC129641, MGC129642, plasma thromboplastic component, Plasma thromboplastin component, PTC |
|---|
| Gene, Accession # | F9, Gene ID: 2158, Accession: NP_000124, SwissProt: NP_000124 |
|---|
| Catalog # | H00002158-M01 |
|---|
| Price | |
|---|
| Order / More Info | Factor IX Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|