| Edit |   |
|---|
| Antigenic Specificity | DENN/MADD Domain Containing 2D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DENN/MADD Domain Containing 2D Antibody from Novus Biologicals is a rabbit polyclonal antibody to DENN/MADD Domain Containing 2D. This antibody reacts with human. The DENN/MADD Domain Containing 2D Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DENN/MADD Domain Containing 2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAI |
|---|
| Other Names | DENN Domain-Containing Protein 2D, DENND2D, RP5-1180E21.2 |
|---|
| Gene, Accession # | DENND2D, Gene ID: 79961, Accession: Q9H6A0, SwissProt: Q9H6A0 |
|---|
| Catalog # | NBP2-30995 |
|---|
| Price | |
|---|
| Order / More Info | DENN/MADD Domain Containing 2D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|