| Edit |   |
|---|
| Antigenic Specificity | DENND2C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DENND2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to DENND2C. This antibody reacts with human. The DENND2C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human DENND2CThe immunogen for this antibody is DENND2C. Peptide sequence DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL. |
|---|
| Other Names | DENN domain-containing protein 2C, DENN/MADD domain containing 2C, DKFZp686N1631 |
|---|
| Gene, Accession # | DENND2C, Gene ID: 163259, Accession: NP_940861, SwissProt: NP_940861 |
|---|
| Catalog # | NBP1-79530 |
|---|
| Price | |
|---|
| Order / More Info | DENND2C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|