| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RAD26L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAD26L Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAD26L. This antibody reacts with human. The RAD26L Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RAD26L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SYFNSSSVNEFAKHITNATSEERQKMLRDFYASQYPEVKEFFVDSVSQFNNSSFEKGEQRTRKKSDKRESLIKPRLSDSETLSFKDSTN |
|---|
| Other Names | C9orf102, chromosome 9 open reading frame 102, EC 3.6.1, EC 3.6.4.-, excision repair cross-complementing rodent repair deficiency, complementation group 6-like 2, FLJ37706, MGC30192, MGC43364, putative repair and recombination helicase RAD26L, RAD26L, SR278, stretch responsive protein 278 |
|---|
| Gene, Accession # | ERCC6L2, Gene ID: 375748 |
|---|
| Catalog # | NBP1-81944 |
|---|
| Price | |
|---|
| Order / More Info | RAD26L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|