| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GCAP1 |
|---|
| Clone | 2F7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA and RNAi Validation. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GCAP1 Antibody (2F7) from Novus Biologicals is a mouse monoclonal antibody to GCAP1. This antibody reacts with human. The GCAP1 Antibody (2F7) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | GUCA1A (NP_000400, 1 a.a. - 93 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLR |
|---|
| Other Names | C6orf131, chromosome 6 open reading frame 131, CORD14, GCAP 1, GCAP1photoreceptor 1, GCAPGUCA, Guanylate cyclase activator 1A, guanylate cyclase activator 1A (retina), guanylin 1, retina, guanylyl cyclase-activating protein 1, GUCA1 |
|---|
| Gene, Accession # | GUCA1A, Gene ID: 2978, Accession: NP_000400, SwissProt: NP_000400 |
|---|
| Catalog # | H00002978-M04 |
|---|
| Price | |
|---|
| Order / More Info | GCAP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|