| Edit |   |
| Antigenic Specificity | GBX2 |
| Clone | 2A4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GBX2 Antibody (2A4) from Novus Biologicals is a mouse monoclonal antibody to GBX2. This antibody reacts with human. The GBX2 Antibody (2A4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | GBX2 (NP_001476 114 a.a. - 182 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG |
| Other Names | Gastrulation and brain-specific homeobox protein 2, gastrulation brain homeo box 2, gastrulation brain homeobox 2, homeobox protein GBX-2 |
| Gene, Accession # | GBX2, Gene ID: 2637, Accession: NP_001476, SwissProt: NP_001476 |
| Catalog # | H00002637-M01 |
| Price | |
| Order / More Info | GBX2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |