| Edit |   |
| Antigenic Specificity | GBX1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GBX1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GBX1. This antibody reacts with human. The GBX1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP. |
| Other Names | gastrulation brain homeo box 1, gastrulation brain homeobox 1, homeobox protein GBX-1 |
| Gene, Accession # | GBX1, Gene ID: 2636, Accession: NP_001092304, SwissProt: NP_001092304 |
| Catalog # | NBP1-91420 |
| Price | |
| Order / More Info | GBX1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |