| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DEF6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DEF6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DEF6. This antibody reacts with human, rat. The DEF6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat DEF6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGG |
|---|
| Other Names | DEF-6, differentially expressed in FDCP 6 homolog, differentially expressed in FDCP 6 homolog (mouse), IBPdifferentially expressed in FDCP (mouse homolog) 6, IRF4-binding protein, SLAT, SWAP70L, SWAP-70-like adaptor protein of T cells |
|---|
| Gene, Accession # | DEF6, Gene ID: 50619 |
|---|
| Catalog # | NBP1-81618 |
|---|
| Price | |
|---|
| Order / More Info | DEF6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|