| Edit |   |
| Antigenic Specificity | CD34 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CD34 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD34. This antibody reacts with human. The CD34 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CD34 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
| Other Names | CD34 antigenhematopoietic progenitor cell antigen CD34, CD34 molecule |
| Gene, Accession # | CD34, Gene ID: 947, Accession: P28906, SwissProt: P28906 |
| Catalog # | NBP2-38322 |
| Price | |
| Order / More Info | CD34 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |