| 产品详情 |
| Edit |   |
| Antigenic Specificity | PSMD7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PSMD7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMD7. This antibody reacts with human. The PSMD7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PSMD7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK |
| Other Names | 26S proteasome non-ATPase regulatory subunit 7, 26S proteasome regulatory subunit RPN8, Moloney leukemia virus-34 proviral integration, Mov34 homolog, Mov34 protein homolog, MOV3426S proteasome regulatory subunit S12, MOV34L, P40, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34 homolog), Proteasome subunit p40, Rpn8, S12 |
| Gene, Accession # | PSMD7, Gene ID: 5713, Accession: P51665, SwissProt: P51665 |
| Catalog # | NBP2-38780 |
| Price | |
| Order / More Info | PSMD7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|