| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PSMD13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PSMD13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMD13. This antibody reacts with human. The PSMD13 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PSMD13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLR |
|---|
| Other Names | HSPC027,26S proteasome regulatory subunit RPN9, p40.5,26S proteasome subunit p40.5,26S proteasome regulatory subunit p40.5, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13,26S proteasome regulatory subunit S11, Rpn9,26S proteasome non-ATPase regulatory subunit 13, S11 |
|---|
| Gene, Accession # | PSMD13, Gene ID: 5719, Accession: Q9UNM6, SwissProt: Q9UNM6 |
|---|
| Catalog # | NBP2-38426 |
|---|
| Price | |
|---|
| Order / More Info | PSMD13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|