Edit |   |
Antigenic Specificity | Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. |
Immunogen | IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL |
Other Names | Ifgr2|Ifgt|AF-1|IFGR2|IFNGT1 |
Gene, Accession # | Gene ID: 3460 |
Catalog # | ABIN635275 |
Price | |
Order / More Info | Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |