| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBE2S |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBE2S Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBE2S. This antibody reacts with human. The UBE2S Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBE2S antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN |
|---|
| Other Names | E2-EPF5, E2-EPFEC 6.3.2.19, E2EPFEPF5, Ubiquitin carrier protein S, ubiquitin-conjugating enzyme E2 S, ubiquitin-conjugating enzyme E2-24 kD, Ubiquitin-conjugating enzyme E2-24 kDa, Ubiquitin-conjugating enzyme E2-EPF5, ubiquitin-conjugating enzyme E2S, Ubiquitin-protein ligase S |
|---|
| Gene, Accession # | UBE2S, Gene ID: 27338, Accession: Q16763, SwissProt: Q16763 |
|---|
| Catalog # | NBP2-38822 |
|---|
| Price | |
|---|
| Order / More Info | UBE2S Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|