| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HMGB3/HMG4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HMGB3/HMG4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HMGB3/HMG4. This antibody reacts with human. The HMGB3/HMG4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HMGB3/HMG4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEE |
|---|
| Other Names | High mobility group protein 2a, High mobility group protein 4, high mobility group protein B3, high-mobility group (nonhistone chromosomal) protein 4, high-mobility group box 3, HMG-2a, HMG2AHMG-4, HMG4MGC90319, non-histone chromosomal protein |
|---|
| Gene, Accession # | HMGB3, Gene ID: 3149 |
|---|
| Catalog # | NBP2-47434 |
|---|
| Price | |
|---|
| Order / More Info | HMGB3/HMG4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|