| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HMGB1/HMG-1 |
|---|
| Clone | 2F6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Block/Neutralize. This antibody reactivity against cell lysate and recombinant protein for WB. IT has been used for IF, IHC-P, and ELISA. B/N usages reported in scientific literature (PMID: 21126167). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HMGB1/HMG-1 Antibody (2F6) from Novus Biologicals is a mouse monoclonal antibody to HMGB1/HMG-1. This antibody reacts with human. The HMGB1/HMG-1 Antibody (2F6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Block/Neutralize. |
|---|
| Immunogen | HMGB1 (NP_002119, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK |
|---|
| Other Names | Amphoterin, high mobility group box 1, High mobility group protein 1, high mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, high-mobility group box 1, HMG-1, HMG1DKFZp686A04236, HMG3, SBP-1, Sulfoglucuronyl carbohydrate binding protein |
|---|
| Gene, Accession # | HMGB1, Gene ID: 3146, Accession: NP_002119, SwissProt: NP_002119 |
|---|
| Catalog # | H00003146-M08 |
|---|
| Price | |
|---|
| Order / More Info | HMGB1/HMG-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19501422, 20379370, 21126167, 21395369, 22345153, 25512109, 25607248, 27308510, 28259445, 29899383 |
|---|
| 产品资料 |
|
|