| Edit |   |
| Antigenic Specificity | PAX8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PAX8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAX8. This antibody reacts with human. The PAX8 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQ |
| Other Names | paired box 8, paired box gene 8, paired box protein Pax-8, paired domain gene 8 |
| Gene, Accession # | PAX8, Gene ID: 7849 |
| Catalog # | NBP1-89436 |
| Price | |
| Order / More Info | PAX8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |