| Edit |   |
|---|
| Antigenic Specificity | Glycogen synthase 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glycogen synthase 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glycogen synthase 2. This antibody reacts with human. The Glycogen synthase 2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GYS2(glycogen synthase 2 (liver)) The peptide sequence was selected from the middle region of GYS2. Peptide sequence TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED. |
|---|
| Other Names | EC 2.4.1.11, glycogen [starch] synthase, liver, glycogen synthase 2 (liver) |
|---|
| Gene, Accession # | GYS2, Gene ID: 2998, Accession: P54840, SwissProt: P54840 |
|---|
| Catalog # | NBP1-55133 |
|---|
| Price | |
|---|
| Order / More Info | Glycogen synthase 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|