| 产品详情 |
| Edit |   |
| Antigenic Specificity | Chorionic Gonadotropin beta Chain (hCG beta) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Chorionic Gonadotropin beta Chain (hCG beta) Antibody from Novus Biologicals is a rabbit polyclonal antibody to Chorionic Gonadotropin beta Chain (hCG beta). This antibody reacts with human. The Chorionic Gonadotropin beta Chain (hCG beta) Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Chorionic Gonadotropin beta Chain (HCG beta) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP |
| Other Names | CGB3choriogonadotropin subunit beta, CGB5, CGB7, CGB8, CG-beta, Chorionic gonadotrophin chain beta, chorionic gonadotropin beta 3 subunit, chorionic gonadotropin beta chain, chorionic gonadotropin beta subunit, chorionic gonadotropin, beta polypeptide, hCGB |
| Gene, Accession # | CGB, Gene ID: 1082 |
| Catalog # | NBP2-54684 |
| Price | |
| Order / More Info | Chorionic Gonadotropin beta Chain (hCG beta) Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|