| 产品详情 |
| Edit |   |
| Antigenic Specificity | MRPL42 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MRPL42 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRPL42. This antibody reacts with human. The MRPL42 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MRPL42 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKD |
| Other Names | 39S ribosomal protein L31, mitochondrial, 39S ribosomal protein L42, mitochondrial, HSPC204,28S ribosomal protein S32, mitochondrial, L31mt, mitochondrial ribosomal protein L42, mitochondrial ribosomal protein S32, MRPL31L42mt, MRP-L31MRP-S32, MRPS32MRP-L42, PTD007, RPML31S32mt |
| Gene, Accession # | MRPL42, Gene ID: 28977 |
| Catalog # | NBP1-83171 |
| Price | |
| Order / More Info | MRPL42 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|