| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRPL38 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRPL38 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRPL38. This antibody reacts with human. The MRPL38 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MRPL38 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRL |
|---|
| Other Names | FLJ13996, HSPC262, KIAA1863, L38MT, MGC4810, mitochondrial ribosomal protein L38,39S ribosomal protein L38, mitochondrial, MRP-L3, MRP-L38, RPML3 |
|---|
| Gene, Accession # | MRPL38, Gene ID: 64978 |
|---|
| Catalog # | NBP1-81672 |
|---|
| Price | |
|---|
| Order / More Info | MRPL38 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25866880 |
|---|
| 产品资料 |
|
|