| Edit |   |
| Antigenic Specificity | SECTM1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SECTM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SECTM1. This antibody reacts with human. The SECTM1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SECTM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRP LALVFKPSPLGALELLSPQPLFPYAAD |
| Other Names | K12secreted and transmembrane protein 1, Protein K-12, secreted and transmembrane 1, type 1a transmembrane protein |
| Gene, Accession # | SECTM1, Gene ID: 6398 |
| Catalog # | NBP2-13292 |
| Price | |
| Order / More Info | SECTM1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |