| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Secretory phospholipase A2 Type V |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Secretory phospholipase A2 Type V Antibody from Novus Biologicals is a rabbit polyclonal antibody to Secretory phospholipase A2 Type V. This antibody reacts with human. The Secretory phospholipase A2 Type V Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PLA2G5(phospholipase A2, group V) The peptide sequence was selected from the middle region of PLA2G5. Peptide sequence YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC. |
|---|
| Other Names | Ca2+-dependent phospholipase A2, calcium-dependent phospholipase A2, DKFZp686C2294, EC 3.1.1.4, Group V phospholipase A2, GV-PLA2, hVPLA(2), MGC46205, Phosphatidylcholine 2-acylhydrolase 5, phospholipase A2, group V, PLA2-10 |
|---|
| Gene, Accession # | PLA2G5, Gene ID: 5322, Accession: P39877, SwissProt: P39877 |
|---|
| Catalog # | NBP1-57906-20ul |
|---|
| Price | |
|---|
| Order / More Info | Secretory phospholipase A2 Type V Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|