| Edit |   |
| Antigenic Specificity | Secretogranin 3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Secretogranin 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Secretogranin 3. This antibody reacts with mouse. The Secretogranin 3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence TGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKG. |
| Other Names | secretogranin IIIFLJ90833, secretogranin-3, SgIII |
| Gene, Accession # | SCG3, Gene ID: 29106, Accession: NP_001158262 |
| Catalog # | NBP1-91632 |
| Price | |
| Order / More Info | Secretogranin 3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |