| Edit |   |
| Antigenic Specificity | Secretogranin 3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Secretogranin 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Secretogranin 3. This antibody reacts with human. The Secretogranin 3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human SCG3. Peptide sequence LQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDS. |
| Other Names | secretogranin IIIFLJ90833, secretogranin-3, SgIII |
| Gene, Accession # | SCG3, Gene ID: 29106, Accession: NP_037375, SwissProt: NP_037375 |
| Catalog # | NBP1-79762-20ul |
| Price | |
| Order / More Info | Secretogranin 3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |