| 产品详情 |
| Edit |   |
| Antigenic Specificity | NFIC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NFIC Antibody from Novus Biologicals is a rabbit polyclonal antibody to NFIC. This antibody reacts with human. The NFIC Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NFIC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS |
| Other Names | CCAAT-binding transcription factor, CTF5, CTFCCAAT-box-binding transcription factor, MGC20153, NF1-C, NFI, NF-I, NF-I/C, NFI-C, nuclear factor 1 C-type, Nuclear factor 1/C, Nuclear factor I/C, nuclear factor I/C (CCAAT-binding transcription factor), TGGCA-binding protein |
| Gene, Accession # | NFIC, Gene ID: 4782, Accession: P08651, SwissProt: P08651 |
| Catalog # | NBP2-37935 |
| Price | |
| Order / More Info | NFIC Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|