| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | epithelial Sodium Channel gamma |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The epithelial Sodium Channel gamma Antibody from Novus Biologicals is a rabbit polyclonal antibody to epithelial Sodium Channel gamma. This antibody reacts with human. The epithelial Sodium Channel gamma Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human epithelial Sodium Channel gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ |
|---|
| Other Names | amiloride-sensitive epithelial sodium channel gamma subunit, amiloride-sensitive sodium channel gamma-subunit, BESC3, ENaC gamma subunit, ENaCG, ENaCgamma, Epithelial Na(+) channel subunit gamma, gamma-ENaC, gamma-NaCH, Nonvoltage-gated sodium channel 1 subunit gamma, PHA1, SCNEGamiloride-sensitive sodium channel subunit gamma, sodium channel, nonvoltage-gated 1, gamma |
|---|
| Gene, Accession # | SCNN1G, Gene ID: 6340 |
|---|
| Catalog # | NBP2-56532 |
|---|
| Price | |
|---|
| Order / More Info | epithelial Sodium Channel gamma Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|