| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NFXL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NFXL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NFXL1. This antibody reacts with human. The NFXL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NFXL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LERTKQYVNEAFQAGAMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWPCPKCRFEYKRSETPS |
|---|
| Other Names | FLJ16294, HOZFP, NF-X1-type zinc finger protein NFXL1, nuclear transcription factor, X-box binding-like 1, Ovarian zinc finger protein, OZFP, up-regulated in colon cancer 5, URCC5 |
|---|
| Gene, Accession # | NFXL1, Gene ID: 152518, Accession: Q6ZNB6, SwissProt: Q6ZNB6 |
|---|
| Catalog # | NBP2-31746 |
|---|
| Price | |
|---|
| Order / More Info | NFXL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|