| Edit |   |
| Antigenic Specificity | NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody from Novus Biologicals is a rabbit polyclonal antibody to NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae). This antibody reacts with human. The NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NFU1 iron-sulfur cluster scaffold homolog (S |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDD |
| Other Names | CGI-33, mitochondrial, Nfu, NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) |
| Gene, Accession # | NFU1, Gene ID: 27247 |
| Catalog # | NBP2-48647 |
| Price | |
| Order / More Info | NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |