| 产品详情 |
| Edit |   |
| Antigenic Specificity | BCL2L12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BCL2L12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCL2L12. This antibody reacts with human. The BCL2L12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BCL2L12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQK |
| Other Names | Bcl-2 related proline-rich protein, bcl2-L-12, BCL2-like 12 (proline rich), bcl-2-like protein 12, Bcl-2-related proline-rich protein, BPR, MGC120313, MGC120314, MGC120315 |
| Gene, Accession # | BCL2L12, Gene ID: 83596 |
| Catalog # | NBP1-86025 |
| Price | |
| Order / More Info | BCL2L12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|