| Edit |   |
|---|
| Antigenic Specificity | CEND1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CEND1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEND1. This antibody reacts with human. The CEND1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CEND1(cell cycle exit and neuronal differentiation 1) The peptide sequence was selected from the N terminal of CEND1. Peptide sequence MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ. |
|---|
| Other Names | BM88 antigen, cell cycle exit and neuronal differentiation 1, cell cycle exit and neuronal differentiation protein 1, FLJ90066 |
|---|
| Gene, Accession # | CEND1, Gene ID: 51286 |
|---|
| Catalog # | NBP1-70495 |
|---|
| Price | |
|---|
| Order / More Info | CEND1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|