| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KRR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KRR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KRR1. This antibody reacts with human, mouse, rat. The KRR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat KRR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEAD |
|---|
| Other Names | HIV-1 Rev binding protein 2, HIV-1 Rev-binding protein 2, HRB2, KRR1 small subunit processome component homolog, KRR1, small subunit (SSU) processome component, homolog (yeast), Rev interacting protein, Rev-interacting protein 1, Rip-1 |
|---|
| Gene, Accession # | KRR1, Gene ID: 11103 |
|---|
| Catalog # | NBP1-92060 |
|---|
| Price | |
|---|
| Order / More Info | KRR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|