| 产品详情 |
| Edit |   |
| Antigenic Specificity | GALM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GALM Antibody from Novus Biologicals is a rabbit polyclonal antibody to GALM. This antibody reacts with human. The GALM Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GALM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFP |
| Other Names | aldose 1-epimerase, BLOCK 25, EC 5.1.3.3, galactomutarotase, Galactose mutarotase, galactose mutarotase (aldose 1-epimerase), IBD1 |
| Gene, Accession # | GALM, Gene ID: 130589, Accession: Q96C23, SwissProt: Q96C23 |
| Catalog # | NBP2-38252 |
| Price | |
| Order / More Info | GALM Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|