| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAH3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAH3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAH3. This antibody reacts with human, mouse. The SAH3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SAH3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI |
|---|
| Other Names | adenosylhomocysteinase-like 2, AdoHcyase 3, ADOHCYASE3, EC 3.3.1.1, FLJ21719, KIAA0828S-adenosylhomocysteine hydrolase-like 2, putative adenosylhomocysteinase 3, S-adenosylhomocysteine hydrolase-like protein 2, S-adenosyl-L-homocysteine hydrolase 3 |
|---|
| Gene, Accession # | AHCYL2, Gene ID: 23382 |
|---|
| Catalog # | NBP2-47293 |
|---|
| Price | |
|---|
| Order / More Info | SAH3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27896923 |
|---|
| 产品资料 |
|
|