Edit |   |
Antigenic Specificity | Transformer 2 beta Homolog (Drosophila) (TRA2B) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, dog |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. |
Immunogen | SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD |
Other Names | sfrs10|SFRS10|Htra2-beta|SRFS10|TRA2-BETA|TRAN2B|5730405G21Rik|D16Ertd266e|SIG-41|Sfrs10|Silg41|TRA2beta|Srsf10|zgc:56612 |
Gene, Accession # | Gene ID: 6434,478663,20462,117259 |
Catalog # | ABIN629994 |
Price | |
Order / More Info | Transformer 2 beta Homolog (Drosophila) (TRA2B) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |