| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD63 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD63. This antibody reacts with human. The CD63 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG |
|---|
| Other Names | CD63 antigen, CD63 antigen (melanoma 1 antigen), CD63 molecule, Granulophysin, LAMP-3, Lysosomal-associated membrane protein 3, ME491, melanoma 1 antigen, Melanoma-associated antigen ME491, melanoma-associated antigen MLA1, MLA1lysosome-associated membrane glycoprotein 3, Ocular melanoma-associated antigen, OMA81H, Tetraspanin-30, tspan-30, TSPAN30granulophysin |
|---|
| Gene, Accession # | CD63, Gene ID: 967 |
|---|
| Catalog # | NBP1-82784-25ul |
|---|
| Price | |
|---|
| Order / More Info | CD63 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|