| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TGDS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TGDS Antibody from Novus Biologicals is a rabbit polyclonal antibody to TGDS. This antibody reacts with human. The TGDS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TGDS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GTNFEMSVVQLAKELIQLIKETNSESEMENWVDYVNDRPTNDMRYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEK |
|---|
| Other Names | dTDP-D-glucose 4,6-dehydratase, EC 4.2.1.46, growth-inhibiting protein 21, P, SDR2E1, short chain dehydrogenase/reductase family 2E, member 1, TDPGD, TDP-glucose 4,6-dehydratase |
|---|
| Gene, Accession # | TGDS, Gene ID: 23483 |
|---|
| Catalog # | NBP1-87063 |
|---|
| Price | |
|---|
| Order / More Info | TGDS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|