| Edit |   |
| Antigenic Specificity | DAZL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 92%, rat 92%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human DAZL polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK |
| Other Names | deleted in azoospermia-like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA |
| Gene, Accession # | Gene ID: 1618, UniProt: Q92904, ENSG00000092345 |
| Catalog # | HPA019777 |
| Price | |
| Order / More Info | DAZL Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |