| 产品详情 |
| Edit |   |
| Antigenic Specificity | Glutathione S-Transferase pi 1/GSTP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Glutathione S-Transferase pi 1/GSTP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glutathione S-Transferase pi 1/GSTP1. This antibody reacts with human. The Glutathione S-Transferase pi 1/GSTP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Glutathione S-Transferase pi 1/GSTP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS |
| Other Names | deafness, X-linked 7, EC 2.5.1.18, FAEES3, fatty acid ethyl ester synthase III, glutathione S-transferase P, glutathione S-transferase pi 1, GST class-pi, GST3DFN7, GSTP, GSTP1-1, PI |
| Gene, Accession # | GSTP1, Gene ID: 2950 |
| Catalog # | NBP1-84747 |
| Price | |
| Order / More Info | Glutathione S-Transferase pi 1/GSTP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 22619634 |
| 产品资料 |
|
|