| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glutathione S-Transferase mu 1/GSTM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glutathione S-Transferase mu 1/GSTM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glutathione S-Transferase mu 1/GSTM1. This antibody reacts with human. The Glutathione S-Transferase mu 1/GSTM1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GSTM1(glutathione S-transferase M1) The peptide sequence was selected from the N terminal of GSTM1. Peptide sequence KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI. |
|---|
| Other Names | EC 2.5.1.18, glutathione S-alkyltransferase, glutathione S-aralkyltransferase, glutathione S-aryltransferase, glutathione S-transferase M1, glutathione S-transferase mu 1, GST class-mu 1, GST HB subunit 4, GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, HB subunit 4, MGC26563, MU, MU-1, S-(hydroxyalkyl)glutathione lyase |
|---|
| Gene, Accession # | GSTM1, Gene ID: 2944, Accession: P46439, SwissProt: P46439 |
|---|
| Catalog # | NBP1-58377 |
|---|
| Price | |
|---|
| Order / More Info | Glutathione S-Transferase mu 1/GSTM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|