| Edit |   |
|---|
| Antigenic Specificity | Glutathione S-transferase Mu 5 |
|---|
| Clone | 1G4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glutathione S-transferase Mu 5 Antibody (1G4) from Novus Biologicals is a mouse monoclonal antibody to Glutathione S-transferase Mu 5. This antibody reacts with human. The Glutathione S-transferase Mu 5 Antibody (1G4) has been validated for the following applications: ELISA. |
|---|
| Immunogen | GSTM5 (NP_000842 145 a.a. - 218 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK |
|---|
| Other Names | EC 2.5.1.18, glutathione S-alkyltransferase M5, glutathione S-aralkyltransferase M5, glutathione S-aryltransferase M5, glutathione S-transferase M5, glutathione S-transferase mu 5, GST class-mu 5, GSTM5-5, GTM5, S-(hydroxyalkyl)glutathione lyase M5 |
|---|
| Gene, Accession # | GSTM5, Gene ID: 2949, Accession: NP_000842, SwissProt: NP_000842 |
|---|
| Catalog # | H00002949-M02 |
|---|
| Price | |
|---|
| Order / More Info | Glutathione S-transferase Mu 5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|