| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glutathione Peroxidase 4/GPX4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glutathione Peroxidase 4/GPX4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glutathione Peroxidase 4/GPX4. This antibody reacts with human, rat. The Glutathione Peroxidase 4/GPX4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to GPX4(glutathione peroxidase 4 (phospholipid hydroperoxidase)) The peptide sequence was selected from the middle region of GPX4. Peptide sequence QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA. |
|---|
| Other Names | EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase |
|---|
| Gene, Accession # | GPX4, Gene ID: 2879, Accession: P36969, SwissProt: P36969 |
|---|
| Catalog # | NBP1-54691 |
|---|
| Price | |
|---|
| Order / More Info | Glutathione Peroxidase 4/GPX4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|