| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EDNRB/Endothelin R Type B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EDNRB/Endothelin R Type B Antibody from Novus Biologicals is a rabbit polyclonal antibody to EDNRB/Endothelin R Type B. This antibody reacts with human. The EDNRB/Endothelin R Type B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EDNRB/Endothelin R Type B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK |
|---|
| Other Names | ABCDS, endothelin B receptor, Endothelin receptor non-selective type, endothelin receptor type B, ETB, ET-B, ETBR, ET-BR, ETRB, HSCR, HSCR2, WS4A |
|---|
| Gene, Accession # | EDNRB, Gene ID: 1910, Accession: P24530, SwissProt: P24530 |
|---|
| Catalog # | NBP2-38136 |
|---|
| Price | |
|---|
| Order / More Info | EDNRB/Endothelin R Type B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|